(data stored in SCRATCH zone)

EMBL: AM420293.PE396

AM420293.PE396       Location/Qualifiers
FT   CDS             451624..452868
FT                   /transl_table=11
FT                   /locus_tag="SACE_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99751"
FT                   /db_xref="GOA:A4F6S7"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6S7"
FT                   /protein_id="CAL99751.1"
FT                   /translation="MVRMSDRGSTESASRDGRATALWVGAVFLAAAATAVLVLSDDSRL
FT                   LKLGLVAALWAALIAAFAVARLRGRAAEDAERAAEQQRIYELELEREVAARREFELEAE
FT                   AEARRRVAEESDSEIQALKTELRNLRESLEQMLGGDVLFERVALRAESTRVRSLTENGA
FT                   TGAQSTSIQQSWGRELTSGPGGHVNGRLTGGVITQAGGTAGPAAPAGSVPPTTVNGTVS
FT                   ANGPGTPNSAGSAAAGGAAPVQGAAPGNGAGTTPAGGKRGGAGGGSTPVTDPIPAAGGA
FT                   SGQSGGAQNTELISRLGGEPPRDEQRRRPSRPPRPKPQPARNETHAAHPAPARREKPQY
FT                   ERPDPAGARSGQQARSGREAPAAESTRKVQAPKAAEEPSPQVDAGAHAEGTSVDELLAA
FT                   YGGSGGTKRRRRRKE"
     MVRMSDRGST ESASRDGRAT ALWVGAVFLA AAATAVLVLS DDSRLLKLGL VAALWAALIA        60
     AFAVARLRGR AAEDAERAAE QQRIYELELE REVAARREFE LEAEAEARRR VAEESDSEIQ       120
     ALKTELRNLR ESLEQMLGGD VLFERVALRA ESTRVRSLTE NGATGAQSTS IQQSWGRELT       180
     SGPGGHVNGR LTGGVITQAG GTAGPAAPAG SVPPTTVNGT VSANGPGTPN SAGSAAAGGA       240
     APVQGAAPGN GAGTTPAGGK RGGAGGGSTP VTDPIPAAGG ASGQSGGAQN TELISRLGGE       300
     PPRDEQRRRP SRPPRPKPQP ARNETHAAHP APARREKPQY ERPDPAGARS GQQARSGREA       360
     PAAESTRKVQ APKAAEEPSP QVDAGAHAEG TSVDELLAAY GGSGGTKRRR RRKE             414
//

If you have problems or comments...

PBIL Back to PBIL home page