(data stored in ACNUC1104 zone)

EMBL: AM420293.PE423

AM420293.PE423       Location/Qualifiers
FT   CDS             complement(484952..485629)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0430"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /function="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99778"
FT                   /db_xref="GOA:A4F6V4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6V4"
FT                   /protein_id="CAL99778.1"
FT                   /translation="MDIDGADFFARGITALGPEGIVFENVDLRFRPGDLGVVTGPGGSG
FT                   RTALLYALAGRLRTVAGYLEVSGYVLPARARAVRKLVLPARLRPGFELEDKYRVREAVT
FT                   EQRLIFGVSELDVEKSLAAVGLDPDPWALVCELHPAERLLLSIALAVAADPAAIVVDDV
FT                   DVGLPRGSRARVWSALRAVAQTGMTVVAGSTDAPPGDAVVVHLPLFQFGEPTEVLSWNG
FT                   GLR"
     MDIDGADFFA RGITALGPEG IVFENVDLRF RPGDLGVVTG PGGSGRTALL YALAGRLRTV        60
     AGYLEVSGYV LPARARAVRK LVLPARLRPG FELEDKYRVR EAVTEQRLIF GVSELDVEKS       120
     LAAVGLDPDP WALVCELHPA ERLLLSIALA VAADPAAIVV DDVDVGLPRG SRARVWSALR       180
     AVAQTGMTVV AGSTDAPPGD AVVVHLPLFQ FGEPTEVLSW NGGLR                       225
//

If you have problems or comments...

PBIL Back to PBIL home page