(data stored in ACNUC1104 zone)

EMBL: AM420293.PE424

AM420293.PE424       Location/Qualifiers
FT   CDS             complement(485788..486315)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99779"
FT                   /db_xref="GOA:A4F6V5"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6V5"
FT                   /protein_id="CAL99779.1"
FT                   /translation="MAHALGLFFDDSAEDAVRALWKRLEAAGVPSLASRGHRRHRPHVT
FT                   LAVAGRIPEGARHDLRAELSLLSVPDLWLYTLGTFPSDESVLLLGAVVDTELIAVHSAV
FT                   HDVLAGKVSAPSAYYFPGAWIPHCTLAIGITGAELAKGFTELCPPEPIRAPVSEIGVID
FT                   TRTGDVETVLAL"
     MAHALGLFFD DSAEDAVRAL WKRLEAAGVP SLASRGHRRH RPHVTLAVAG RIPEGARHDL        60
     RAELSLLSVP DLWLYTLGTF PSDESVLLLG AVVDTELIAV HSAVHDVLAG KVSAPSAYYF       120
     PGAWIPHCTL AIGITGAELA KGFTELCPPE PIRAPVSEIG VIDTRTGDVE TVLAL            175
//

If you have problems or comments...

PBIL Back to PBIL home page