(data stored in ACNUC1104 zone)

EMBL: AM420293.PE427

AM420293.PE427       Location/Qualifiers
FT   CDS             487955..488572
FT                   /transl_table=11
FT                   /locus_tag="SACE_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99782"
FT                   /db_xref="GOA:A4F6V8"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6V8"
FT                   /protein_id="CAL99782.1"
FT                   /translation="MSVASGTLGSAGATFSRVMDPMGPLPSAVYWRRRAVALSAAALAV
FT                   VLSGWAVVAVTGGEPRPRAASAPPPPPPTACPDRALRIVAEPLKPEFRLGDGVGLRIVV
FT                   INDGDRACLRDTNRELRELRVTTPDGEHVWGSNDCYRESTNEVPLLRPGQSVHNDVLWT
FT                   GERSAPECPPTAEVAPAGEYLLVARLGGLTSRPVPFRLIGQS"
     MSVASGTLGS AGATFSRVMD PMGPLPSAVY WRRRAVALSA AALAVVLSGW AVVAVTGGEP        60
     RPRAASAPPP PPPTACPDRA LRIVAEPLKP EFRLGDGVGL RIVVINDGDR ACLRDTNREL       120
     RELRVTTPDG EHVWGSNDCY RESTNEVPLL RPGQSVHNDV LWTGERSAPE CPPTAEVAPA       180
     GEYLLVARLG GLTSRPVPFR LIGQS                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page