(data stored in ACNUC1104 zone)

EMBL: AM420293.PE434

AM420293.PE434       Location/Qualifiers
FT   CDS             494095..494244
FT                   /transl_table=11
FT                   /locus_tag="SACE_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99789"
FT                   /db_xref="GOA:A4F6W5"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6W5"
FT                   /protein_id="CAL99789.1"
FT                   /translation="MVAWPCSWFLWSSGGGVNLAVAVVLLWASALGSVVAIVAPMRRQE
FT                   ARRC"
     MVAWPCSWFL WSSGGGVNLA VAVVLLWASA LGSVVAIVAP MRRQEARRC                    49
//

If you have problems or comments...

PBIL Back to PBIL home page