(data stored in ACNUC1104 zone)

EMBL: AM420293.PE438

AM420293.PE438       Location/Qualifiers
FT   CDS             complement(497658..498710)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0445"
FT                   /product="conserved hypothetical protein (putative membrane
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99793"
FT                   /db_xref="GOA:A4F6W9"
FT                   /db_xref="InterPro:IPR005552"
FT                   /db_xref="InterPro:IPR018929"
FT                   /db_xref="InterPro:IPR025659"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6W9"
FT                   /protein_id="CAL99793.1"
FT                   /translation="MSAPPPPGWYPDQADPRYVRWWDGRQWTPHAQPAQPQPAAQQQPQ
FT                   PAAQPQPMAQPGPAAQPQQPGPPQPMPPQAPAAQPLAPGQPMPPGTPAPGQPVQQPGRP
FT                   FQQGPHQSPMPQAEDSSSIELALGGTGDSASVQQQVQQRAGVGGHVGGGGGTLFTEPVL
FT                   VVNQKAKLIEMANEYAVYDQTGRQIGSVVQTGQSGAQKALRLLTKLDSLMTVTLEIRDV
FT                   AGQPVLRLTRPATMWKSTVHVQRPDGSPVGDIRMENVWGKVRFAFEAGGQRVGGIHAEN
FT                   LRAWDLRVLDRDEQQVGQISKTWQGLAKAAFTTADNYVLQIFRPLPEPLNSLVVASALT
FT                   VDTVLGQAQR"
     MSAPPPPGWY PDQADPRYVR WWDGRQWTPH AQPAQPQPAA QQQPQPAAQP QPMAQPGPAA        60
     QPQQPGPPQP MPPQAPAAQP LAPGQPMPPG TPAPGQPVQQ PGRPFQQGPH QSPMPQAEDS       120
     SSIELALGGT GDSASVQQQV QQRAGVGGHV GGGGGTLFTE PVLVVNQKAK LIEMANEYAV       180
     YDQTGRQIGS VVQTGQSGAQ KALRLLTKLD SLMTVTLEIR DVAGQPVLRL TRPATMWKST       240
     VHVQRPDGSP VGDIRMENVW GKVRFAFEAG GQRVGGIHAE NLRAWDLRVL DRDEQQVGQI       300
     SKTWQGLAKA AFTTADNYVL QIFRPLPEPL NSLVVASALT VDTVLGQAQR                  350
//

If you have problems or comments...

PBIL Back to PBIL home page