(data stored in ACNUC1104 zone)

EMBL: AM420293.PE448

AM420293.PE448       Location/Qualifiers
FT   CDS             507537..508637
FT                   /transl_table=11
FT                   /locus_tag="SACE_0455"
FT                   /product="transcriptional regulatory protein (probably
FT                   LacI-family)"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99803"
FT                   /db_xref="GOA:A4F6X9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6X9"
FT                   /protein_id="CAL99803.1"
FT                   /translation="MARSTNARRPATLASLAAELGVSRTTVSNAYNRPDQLSPELRKRV
FT                   LDTARRLGYPGPDPVARSLRTRKAGAVGLLLTENLSYAFRDPGAISFLEGLSLACEDAG
FT                   HGLLLIPASPEREDVASVHRAGVDGFVVYSVPEDDPHLAAVLERPVPVVVCDQPRLDNL
FT                   DWVGPDDARAIKSMADHLIKLGHRRIGVSCMRLARGRNDGLASVQRQANASFHVQKSRL
FT                   TALAESFSEAGVDWTKVPVVERFDHTAASGASAARQLLDLDPDITAIVCTSDILALGAL
FT                   NEARSRGLRVPEDLTVTGFDGIADAERAGLTTVRQPVLEKGRAAGRLLLETSEPGRPRE
FT                   VVLETQLITGTTAAPPRSREERWFGP"
     MARSTNARRP ATLASLAAEL GVSRTTVSNA YNRPDQLSPE LRKRVLDTAR RLGYPGPDPV        60
     ARSLRTRKAG AVGLLLTENL SYAFRDPGAI SFLEGLSLAC EDAGHGLLLI PASPEREDVA       120
     SVHRAGVDGF VVYSVPEDDP HLAAVLERPV PVVVCDQPRL DNLDWVGPDD ARAIKSMADH       180
     LIKLGHRRIG VSCMRLARGR NDGLASVQRQ ANASFHVQKS RLTALAESFS EAGVDWTKVP       240
     VVERFDHTAA SGASAARQLL DLDPDITAIV CTSDILALGA LNEARSRGLR VPEDLTVTGF       300
     DGIADAERAG LTTVRQPVLE KGRAAGRLLL ETSEPGRPRE VVLETQLITG TTAAPPRSRE       360
     ERWFGP                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page