(data stored in SCRATCH zone)

EMBL: AM420293.PE450

AM420293.PE450       Location/Qualifiers
FT   CDS             complement(510411..510836)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99805"
FT                   /db_xref="GOA:A4F6Y1"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y1"
FT                   /protein_id="CAL99805.1"
FT                   /translation="MLQELLSGLLAAVAYGVIGVLMMALGYVLVDLATPGRLRDLIWVQ
FT                   RNPNAALLLVSGLTGVGVILTTAIAASADDLIAGLVGTLAYGLLGLVLMSLSFLLIDAL
FT                   TPGKLGDELASPNMHPGTWVSAVAHVVISVLIAAAIW"
     MLQELLSGLL AAVAYGVIGV LMMALGYVLV DLATPGRLRD LIWVQRNPNA ALLLVSGLTG        60
     VGVILTTAIA ASADDLIAGL VGTLAYGLLG LVLMSLSFLL IDALTPGKLG DELASPNMHP       120
     GTWVSAVAHV VISVLIAAAI W                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page