(data stored in ACNUC1104 zone)

EMBL: AM420293.PE452

AM420293.PE452       Location/Qualifiers
FT   CDS             complement(511881..512318)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99807"
FT                   /db_xref="InterPro:IPR025341"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y3"
FT                   /protein_id="CAL99807.1"
FT                   /translation="MKPRLWFLLGGICAVLALVIALVMIFSTGTGPRGYVANHYQRAAH
FT                   LDLRGDDDNRAYTSPLTPSVVSREITSRWQPVAQAADTSGIYLRYKDDAVIVQPRDRGS
FT                   VIHVMDVDHAYHRYHSHVGGTWGWIGTHGESFRGRGPGAGK"
     MKPRLWFLLG GICAVLALVI ALVMIFSTGT GPRGYVANHY QRAAHLDLRG DDDNRAYTSP        60
     LTPSVVSREI TSRWQPVAQA ADTSGIYLRY KDDAVIVQPR DRGSVIHVMD VDHAYHRYHS       120
     HVGGTWGWIG THGESFRGRG PGAGK                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page