(data stored in ACNUC1104 zone)

EMBL: AM420293.PE453

AM420293.PE453       Location/Qualifiers
FT   CDS             complement(512315..512944)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99808"
FT                   /db_xref="GOA:A4F6Y4"
FT                   /db_xref="InterPro:IPR025235"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y4"
FT                   /protein_id="CAL99808.1"
FT                   /translation="MKVVLAIVVVILAIMAVAAVVYLVYTRRGGGDQRAAAPRDPFHTG
FT                   DEDSLRGDPRALKAGDIVEIRGHSYTVRGSLRLSEGGWKWSEHLLDDAKGGQVWLSVEE
FT                   DPDLVLAQWLPAADAGEPGASTIEFGGRTYRSDESGSASFRSEATTGLDEQGTVGYHDY
FT                   EASDGSLLSFERYGDAGWEASTGEQLSRYDVLIYPTAGGTGQEGGR"
     MKVVLAIVVV ILAIMAVAAV VYLVYTRRGG GDQRAAAPRD PFHTGDEDSL RGDPRALKAG        60
     DIVEIRGHSY TVRGSLRLSE GGWKWSEHLL DDAKGGQVWL SVEEDPDLVL AQWLPAADAG       120
     EPGASTIEFG GRTYRSDESG SASFRSEATT GLDEQGTVGY HDYEASDGSL LSFERYGDAG       180
     WEASTGEQLS RYDVLIYPTA GGTGQEGGR                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page