(data stored in ACNUC1104 zone)

EMBL: AM420293.PE456

AM420293.PE456       Location/Qualifiers
FT   CDS             complement(517594..519045)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0463"
FT                   /product="possible amino acid export carrier protein"
FT                   /function="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99811"
FT                   /db_xref="GOA:A4F6Y7"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y7"
FT                   /protein_id="CAL99811.1"
FT                   /translation="MGITQRARGVLRRREPAVSAGNRNVVYGPALPDESAVHLVLDLGL
FT                   RIGEIQMSSGAGASDVTATIIAVANAYGLPHCEVDVIYTSITVSCYRGTESLPITSLRV
FT                   VRNRSLDYTRLSETEALVRRITANELSAADAYAELNRISTAPHPFPRWVATLAWAGMAA
FT                   SLAVLLGGGADWRLPLIAAATAALIDRVGRVLNRRALPFFFQQAVGGAVATTIAMGCFA
FT                   TGLLPNPALAVAASIIVLLSGMTVVGSMQDAITGYNVTAAGRITELALMSAGLIAGVVV
FT                   ALYAGLRIFGSDALGGANFDEAMLQNFGRAQVTSPVLLPLVQLAAGASTSACFALASYA
FT                   PPRPLVVAGVGGAVAAFVHAVLTLADVHTVLAGAVATTIVGFIGGIIARRLRIPALVIA
FT                   VSGVAPLLPGLATYRGLYELSVLGSPTGVSTLMLAVAIGLALGSGVVLGEYLAQPVRTR
FT                   LGRLERRFAGPRMSGPLRPTRRRLE"
     MGITQRARGV LRRREPAVSA GNRNVVYGPA LPDESAVHLV LDLGLRIGEI QMSSGAGASD        60
     VTATIIAVAN AYGLPHCEVD VIYTSITVSC YRGTESLPIT SLRVVRNRSL DYTRLSETEA       120
     LVRRITANEL SAADAYAELN RISTAPHPFP RWVATLAWAG MAASLAVLLG GGADWRLPLI       180
     AAATAALIDR VGRVLNRRAL PFFFQQAVGG AVATTIAMGC FATGLLPNPA LAVAASIIVL       240
     LSGMTVVGSM QDAITGYNVT AAGRITELAL MSAGLIAGVV VALYAGLRIF GSDALGGANF       300
     DEAMLQNFGR AQVTSPVLLP LVQLAAGAST SACFALASYA PPRPLVVAGV GGAVAAFVHA       360
     VLTLADVHTV LAGAVATTIV GFIGGIIARR LRIPALVIAV SGVAPLLPGL ATYRGLYELS       420
     VLGSPTGVST LMLAVAIGLA LGSGVVLGEY LAQPVRTRLG RLERRFAGPR MSGPLRPTRR       480
     RLE                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page