(data stored in ACNUC1104 zone)

EMBL: AM420293.PE458

AM420293.PE458       Location/Qualifiers
FT   CDS             complement(521245..521859)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99813"
FT                   /db_xref="GOA:A4F6Y9"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y9"
FT                   /protein_id="CAL99813.1"
FT                   /translation="MNGPVSPAGASGYPLAIHWPGPLGTACENAPQVGKWMPGGSGVEA
FT                   AIPGGFPPTRPPTHSTTRHQAQPRPGGQVDRVNTPPGNTSARRCRAVRTVHPPRSNRPP
FT                   TTTPGRPTMTPLDITGRVLAVLAALALLTAAAVAVLLWRAVLPVILIAALAVTLGMVRT
FT                   LALGGFAALAALRGLMLALDRAGTAVPTPRLRTARPSAHTR"
     MNGPVSPAGA SGYPLAIHWP GPLGTACENA PQVGKWMPGG SGVEAAIPGG FPPTRPPTHS        60
     TTRHQAQPRP GGQVDRVNTP PGNTSARRCR AVRTVHPPRS NRPPTTTPGR PTMTPLDITG       120
     RVLAVLAALA LLTAAAVAVL LWRAVLPVIL IAALAVTLGM VRTLALGGFA ALAALRGLML       180
     ALDRAGTAVP TPRLRTARPS AHTR                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page