(data stored in ACNUC1104 zone)

EMBL: AM420293.PE463

AM420293.PE463       Location/Qualifiers
FT   CDS             complement(525536..525913)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99818"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Z4"
FT                   /protein_id="CAL99818.1"
FT                   /translation="MSVRLRQYRTARGWSQKTACQHLAEAARSRGIRAHSPGTLLGLLG
FT                   EWERGVRVVSSTYQQLWAEVYGTTPGMLGIAGAWSRNHPVVTRADIERGAPTPQVVSSP
FT                   KDPLIGGLSGAERIELEGVAA"
     MSVRLRQYRT ARGWSQKTAC QHLAEAARSR GIRAHSPGTL LGLLGEWERG VRVVSSTYQQ        60
     LWAEVYGTTP GMLGIAGAWS RNHPVVTRAD IERGAPTPQV VSSPKDPLIG GLSGAERIEL       120
     EGVAA                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page