(data stored in SCRATCH zone)

EMBL: AM420293.PE464

AM420293.PE464       Location/Qualifiers
FT   CDS             complement(525919..526320)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99819"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Z5"
FT                   /protein_id="CAL99819.1"
FT                   /translation="MRLHTERAQGMVGDHHATFIPTHREDNDTPIVMQVSMSVPVSLED
FT                   IEAVFWIAVNGGMLLDERELGNDQYAHEMVLETFLHEGSNRICLAREEIEDIKPGSGDY
FT                   ALLMMIRRRVAELYGRPGVPAPRRALTRA"
     MRLHTERAQG MVGDHHATFI PTHREDNDTP IVMQVSMSVP VSLEDIEAVF WIAVNGGMLL        60
     DERELGNDQY AHEMVLETFL HEGSNRICLA REEIEDIKPG SGDYALLMMI RRRVAELYGR       120
     PGVPAPRRAL TRA                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page