(data stored in ACNUC1104 zone)

EMBL: AM420293.PE467

AM420293.PE467       Location/Qualifiers
FT   CDS             complement(527153..527332)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99822"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Z8"
FT                   /protein_id="CAL99822.1"
FT                   /translation="MAKQSFPMMKTGGGVLPKLFGWAVLIVVVVMVVQQPTESAEFVKT
FT                   TFGALKTFFGAVAG"
     MAKQSFPMMK TGGGVLPKLF GWAVLIVVVV MVVQQPTESA EFVKTTFGAL KTFFGAVAG         59
//

If you have problems or comments...

PBIL Back to PBIL home page