(data stored in ACNUC1104 zone)

EMBL: AM420293.PE470

AM420293.PE470       Location/Qualifiers
FT   CDS             529484..529735
FT                   /transl_table=11
FT                   /locus_tag="SACE_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99825"
FT                   /db_xref="UniProtKB/TrEMBL:A4F701"
FT                   /protein_id="CAL99825.1"
FT                   /translation="MGSFVGRACSEVLCHLISGNRSAGCHVGESFAEVPYELGVGEHFD
FT                   RFSQPIDLARRHDVGNVLAMRDDGHALATFGTLDGFVP"
     MGSFVGRACS EVLCHLISGN RSAGCHVGES FAEVPYELGV GEHFDRFSQP IDLARRHDVG        60
     NVLAMRDDGH ALATFGTLDG FVP                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page