(data stored in SCRATCH zone)

EMBL: AM420293.PE471

AM420293.PE471       Location/Qualifiers
FT   CDS             complement(530505..530738)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99826"
FT                   /db_xref="InterPro:IPR028037"
FT                   /db_xref="UniProtKB/TrEMBL:A4F702"
FT                   /protein_id="CAL99826.1"
FT                   /translation="MSIMDKLKEFVGKSPDKFHRGIDKAASAADEKTGGKHSDKINRGA
FT                   EQARKYVDRQGEQGGPEQGGAGRPPGGGPGQP"
     MSIMDKLKEF VGKSPDKFHR GIDKAASAAD EKTGGKHSDK INRGAEQARK YVDRQGEQGG        60
     PEQGGAGRPP GGGPGQP                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page