(data stored in ACNUC1104 zone)

EMBL: AM420293.PE474

AM420293.PE474       Location/Qualifiers
FT   CDS             complement(531497..531994)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99829"
FT                   /db_xref="UniProtKB/TrEMBL:A4F705"
FT                   /protein_id="CAL99829.1"
FT                   /translation="MSKRWSSWNTGTKLSAIGALLALLTLLGSSISWLADGLSVRDRLW
FT                   GKEEPPPATRTTASASADTPAPTTPVAEPESDEVNLLDADAVEGGDYVAVGRATVAGRN
FT                   PERALVHPGTSVTTYNADGMRELRARAALDDHSQSCAVTFEVRSTARCASAAPCAPARS
FT                   WN"
     MSKRWSSWNT GTKLSAIGAL LALLTLLGSS ISWLADGLSV RDRLWGKEEP PPATRTTASA        60
     SADTPAPTTP VAEPESDEVN LLDADAVEGG DYVAVGRATV AGRNPERALV HPGTSVTTYN       120
     ADGMRELRAR AALDDHSQSC AVTFEVRSTA RCASAAPCAP ARSWN                       165
//

If you have problems or comments...

PBIL Back to PBIL home page