(data stored in SCRATCH zone)

EMBL: AM420293.PE476

AM420293.PE476       Location/Qualifiers
FT   CDS             532918..533646
FT                   /transl_table=11
FT                   /locus_tag="SACE_0482"
FT                   /product="hydrolase"
FT                   /function="Trypsin-like serine proteases, typically
FT                   ,contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99831"
FT                   /db_xref="GOA:A4F707"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A4F707"
FT                   /protein_id="CAL99831.1"
FT                   /translation="MSIARTLAGAVGAALAMATFAAPAQAAEPTPPPDMRPMIIDGSEV
FT                   DSAPWAARLFVNGQENCSATIIAPEWVLTAQHCVDGAGDGVSFNIGNVDQTQGEKANAK
FT                   PGGVHVHDTADLALVNIDHAVQTEYAPLGSTGDVNVGDTAQTYGWGATCTDKPEIQCQS
FT                   QILKVANVNVTDIACQDYRGGTAVCATRGDGIPAGGDSGGPMFANNVQVGVASTSDRAE
FT                   NTAYTNITEYRDWIKQLAGV"
     MSIARTLAGA VGAALAMATF AAPAQAAEPT PPPDMRPMII DGSEVDSAPW AARLFVNGQE        60
     NCSATIIAPE WVLTAQHCVD GAGDGVSFNI GNVDQTQGEK ANAKPGGVHV HDTADLALVN       120
     IDHAVQTEYA PLGSTGDVNV GDTAQTYGWG ATCTDKPEIQ CQSQILKVAN VNVTDIACQD       180
     YRGGTAVCAT RGDGIPAGGD SGGPMFANNV QVGVASTSDR AENTAYTNIT EYRDWIKQLA       240
     GV                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page