(data stored in SCRATCH zone)

EMBL: AM420293.PE48

AM420293.PE48        Location/Qualifiers
FT   CDS             complement(67549..68862)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0050"
FT                   /product="FHA domain containing protein"
FT                   /function="FOG: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99403"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5S9"
FT                   /protein_id="CAL99403.1"
FT                   /translation="MGLVQRFERRLEGIVGNGFARVFGGKVVPQEVAQALQREAELQIR
FT                   ELAGGRLLACNHYVVQLSTPDHARLAGEEDRVTDLLADCVQEHLTEQGWDTYGDVVVSL
FT                   ERSETLHTGQFRIRSSVDPDVTRRPATPRTAGDRPMSQPPGHYPQGDPYGQQQGQYGYD
FT                   QGYGQGQYGQDPNYGYGQQPPGYDQGGYPQQPPGYDQGYPQQGYGQQPPGYDQGYGQPA
FT                   GYDQGYGQQPGGYDQGGYPQQPPAAYDQGYGQQPPGYDQGYGQPAGYDQGYGQQPPGYD
FT                   QGYPQQPGQYGYDQGGYGQQPGGAYPPSQPGGFPEQGYPQQPGGAYPPSAPGGYPEAAP
FT                   RQLTATLQLDDGSNRSYTLQHGSNVIGRGQEGQFRLPDTGVSRKHIEITWDGQSAMLAD
FT                   LGSTNGTTVNGTPVQTWQLADGDVIRVGHSSLVFRSQG"
     MGLVQRFERR LEGIVGNGFA RVFGGKVVPQ EVAQALQREA ELQIRELAGG RLLACNHYVV        60
     QLSTPDHARL AGEEDRVTDL LADCVQEHLT EQGWDTYGDV VVSLERSETL HTGQFRIRSS       120
     VDPDVTRRPA TPRTAGDRPM SQPPGHYPQG DPYGQQQGQY GYDQGYGQGQ YGQDPNYGYG       180
     QQPPGYDQGG YPQQPPGYDQ GYPQQGYGQQ PPGYDQGYGQ PAGYDQGYGQ QPGGYDQGGY       240
     PQQPPAAYDQ GYGQQPPGYD QGYGQPAGYD QGYGQQPPGY DQGYPQQPGQ YGYDQGGYGQ       300
     QPGGAYPPSQ PGGFPEQGYP QQPGGAYPPS APGGYPEAAP RQLTATLQLD DGSNRSYTLQ       360
     HGSNVIGRGQ EGQFRLPDTG VSRKHIEITW DGQSAMLADL GSTNGTTVNG TPVQTWQLAD       420
     GDVIRVGHSS LVFRSQG                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page