(data stored in ACNUC1104 zone)

EMBL: AM420293.PE483

AM420293.PE483       Location/Qualifiers
FT   CDS             complement(542553..543395)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0489"
FT                   /product="lipolytic enzyme, G-D-S-L family"
FT                   /function="Lysophospholipase L1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99838"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A4F714"
FT                   /protein_id="CAL99838.1"
FT                   /translation="MGGWERSSAVDATSLGSYVALGDSFTEGMEDARPDGGYRGWADRL
FT                   AERLAARNPGLRYANLAVRGKLIRQIVDDQVPEAIGLRPGLVSFTAGGNDIIRPGSDPD
FT                   AVAELFESAVAELSATGARLLIGTGFDTRDTPVLRHVRGKVGTYNSHLRAIADKYDCGV
FT                   IDLWSMQVLQDPRAWSADRLHLSPEGHRRVALRAAEALGLPVTEDWREPWPPRPEQSWR
FT                   TQRIQDIQWAREYLAPWIGRRLRGQSSGDGRAPKRPKLERLCGAQSSASASPSEAERC"
     MGGWERSSAV DATSLGSYVA LGDSFTEGME DARPDGGYRG WADRLAERLA ARNPGLRYAN        60
     LAVRGKLIRQ IVDDQVPEAI GLRPGLVSFT AGGNDIIRPG SDPDAVAELF ESAVAELSAT       120
     GARLLIGTGF DTRDTPVLRH VRGKVGTYNS HLRAIADKYD CGVIDLWSMQ VLQDPRAWSA       180
     DRLHLSPEGH RRVALRAAEA LGLPVTEDWR EPWPPRPEQS WRTQRIQDIQ WAREYLAPWI       240
     GRRLRGQSSG DGRAPKRPKL ERLCGAQSSA SASPSEAERC                             280
//

If you have problems or comments...

PBIL Back to PBIL home page