(data stored in ACNUC1104 zone)

EMBL: AM420293.PE484

AM420293.PE484       Location/Qualifiers
FT   CDS             545858..546325
FT                   /transl_table=11
FT                   /locus_tag="SACE_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99839"
FT                   /db_xref="UniProtKB/TrEMBL:A4F715"
FT                   /protein_id="CAL99839.1"
FT                   /translation="MQPPPGEQHPVHQQPGPGPQPGPSQQQPGPGPQQPGPAQQPGHGQ
FT                   QPPAKPAQKPAPRPPKPAARADGGFGPIGSGGWQQSSRGSNYDRSPTKWGAEEVKDEYR
FT                   DAEYRAPRQGETGDAPQFLIEADDLYDEDYGESRLVAPPVLGEAPSSYRDF"
     MQPPPGEQHP VHQQPGPGPQ PGPSQQQPGP GPQQPGPAQQ PGHGQQPPAK PAQKPAPRPP        60
     KPAARADGGF GPIGSGGWQQ SSRGSNYDRS PTKWGAEEVK DEYRDAEYRA PRQGETGDAP       120
     QFLIEADDLY DEDYGESRLV APPVLGEAPS SYRDF                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page