(data stored in ACNUC1104 zone)

EMBL: AM420293.PE490

AM420293.PE490       Location/Qualifiers
FT   CDS             550344..551186
FT                   /transl_table=11
FT                   /locus_tag="SACE_0497"
FT                   /product="hypothetical protein"
FT                   /function="predicted metal-dependent hydrolase of the
FT                   TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99845"
FT                   /db_xref="GOA:A4F721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4F721"
FT                   /protein_id="CAL99845.1"
FT                   /translation="MTVDTHHHLWDLDVRDQPWMTGPEMQPLRRDFRPADLVAALRGTT
FT                   VDSTVLVQTVSDPDETPEMLVLADSCDRIAGVVGWTDLTARDVRERLGHLLSNPSGRWL
FT                   KGIRHQVEDEPDPDWLTRPEVLSGLAAVEDAGLLYELLVRPHQLPAAIKAVGQFPQLTF
FT                   VLDHCAKPPVASGELEPWESRIRALAAHPNVVCKLSGLVTEDDWSAQPDAGRLRPYAEV
FT                   VLDAFGPARVMFGSDWPVCLLAAEYGEVFRLAWELTSGLGDAARQAVFDTTARQVYEL"
     MTVDTHHHLW DLDVRDQPWM TGPEMQPLRR DFRPADLVAA LRGTTVDSTV LVQTVSDPDE        60
     TPEMLVLADS CDRIAGVVGW TDLTARDVRE RLGHLLSNPS GRWLKGIRHQ VEDEPDPDWL       120
     TRPEVLSGLA AVEDAGLLYE LLVRPHQLPA AIKAVGQFPQ LTFVLDHCAK PPVASGELEP       180
     WESRIRALAA HPNVVCKLSG LVTEDDWSAQ PDAGRLRPYA EVVLDAFGPA RVMFGSDWPV       240
     CLLAAEYGEV FRLAWELTSG LGDAARQAVF DTTARQVYEL                             280
//

If you have problems or comments...

PBIL Back to PBIL home page