(data stored in SCRATCH zone)

EMBL: AM420293.PE5

AM420293.PE5         Location/Qualifiers
FT   CDS             6543..7064
FT                   /transl_table=11
FT                   /locus_tag="SACE_0006"
FT                   /product="hypothetical protein"
FT                   /function="Zn-ribbon-containing, possibly RNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99360"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5N6"
FT                   /protein_id="CAL99360.1"
FT                   /translation="MAMGTDGAALNGPDLARAALQAAREQSKAKRSTARRRYGGGGQRR
FT                   RRSWSGPGADDRDPQPLGRLASRIAAERGWADRLSGGRVFGEWSTLVGGDIAEHTKPVA
FT                   LKDGELSVQAESTAWATQLRLLQRQILKRIADGVGKDVVRRIKVQGPAAPSWRHGPRHI
FT                   PGRGPRDTYG"
     MAMGTDGAAL NGPDLARAAL QAAREQSKAK RSTARRRYGG GGQRRRRSWS GPGADDRDPQ        60
     PLGRLASRIA AERGWADRLS GGRVFGEWST LVGGDIAEHT KPVALKDGEL SVQAESTAWA       120
     TQLRLLQRQI LKRIADGVGK DVVRRIKVQG PAAPSWRHGP RHIPGRGPRD TYG              173
//

If you have problems or comments...

PBIL Back to PBIL home page