(data stored in ACNUC1104 zone)

EMBL: AM420293.PE503

AM420293.PE503       Location/Qualifiers
FT   CDS             566926..567495
FT                   /transl_table=11
FT                   /locus_tag="SACE_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99858"
FT                   /db_xref="GOA:A4F734"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A4F734"
FT                   /protein_id="CAL99858.1"
FT                   /translation="MSVAPVSPLMGWEDLVHTWQDLDVPEGWRAEIIEGRIVMTPPPGH
FT                   SHNLIASRLTKALVPAMSDDWEIFQTSGVQIPLRGNLFIPDLMIMRGQDVPAGSDPIPA
FT                   DKALLVVEITSRGNADVDRKTKLWSYAHAAVPLYLLIDRYGPDGEWVSLHSNPESGVYQ
FT                   DVHRVPFGKPIDLPVPFRLTLDTDRL"
     MSVAPVSPLM GWEDLVHTWQ DLDVPEGWRA EIIEGRIVMT PPPGHSHNLI ASRLTKALVP        60
     AMSDDWEIFQ TSGVQIPLRG NLFIPDLMIM RGQDVPAGSD PIPADKALLV VEITSRGNAD       120
     VDRKTKLWSY AHAAVPLYLL IDRYGPDGEW VSLHSNPESG VYQDVHRVPF GKPIDLPVPF       180
     RLTLDTDRL                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page