(data stored in SCRATCH zone)

EMBL: AM420293.PE504

AM420293.PE504       Location/Qualifiers
FT   CDS             567567..568151
FT                   /transl_table=11
FT                   /locus_tag="SACE_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99859"
FT                   /db_xref="GOA:A4F735"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A4F735"
FT                   /protein_id="CAL99859.1"
FT                   /translation="MVYTPSGQQAPPLWANWEYLVGAWQGLNIPEGWRLELIEERLVPV
FT                   SPPEYRHGQIVDVLHRDFAARSPRDAAVFRTVSVVIPSRRSLFIPDLLVAAESRAASDA
FT                   VSVEAEKTLLVAEISGKAESAGDRELKLWSYAHAGAPLYLVVDPWAKGGSVVRLYSEPH
FT                   NAAYLRCAEVRFGEVIEVPEPFGFSLDTAEF"
     MVYTPSGQQA PPLWANWEYL VGAWQGLNIP EGWRLELIEE RLVPVSPPEY RHGQIVDVLH        60
     RDFAARSPRD AAVFRTVSVV IPSRRSLFIP DLLVAAESRA ASDAVSVEAE KTLLVAEISG       120
     KAESAGDREL KLWSYAHAGA PLYLVVDPWA KGGSVVRLYS EPHNAAYLRC AEVRFGEVIE       180
     VPEPFGFSLD TAEF                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page