(data stored in ACNUC1104 zone)

EMBL: AM420293.PE508

AM420293.PE508       Location/Qualifiers
FT   CDS             570089..570346
FT                   /transl_table=11
FT                   /locus_tag="SACE_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99863"
FT                   /db_xref="UniProtKB/TrEMBL:A4F739"
FT                   /protein_id="CAL99863.1"
FT                   /translation="MAAQRWVREVLLGEHSFVFLVELADAGEADRFRDACAANQWTTRV
FT                   VEDAERRLPLAPADQAEVYRKLQLATRVWGRSFAPHQRPR"
     MAAQRWVREV LLGEHSFVFL VELADAGEAD RFRDACAANQ WTTRVVEDAE RRLPLAPADQ        60
     AEVYRKLQLA TRVWGRSFAP HQRPR                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page