(data stored in ACNUC1104 zone)

EMBL: AM420293.PE509

AM420293.PE509       Location/Qualifiers
FT   CDS             570420..570905
FT                   /transl_table=11
FT                   /locus_tag="SACE_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99864"
FT                   /db_xref="GOA:A4F740"
FT                   /db_xref="UniProtKB/TrEMBL:A4F740"
FT                   /protein_id="CAL99864.1"
FT                   /translation="MAAVPSVAGRIAGAVAERAEDRLARSLWRSHLVLEGAGFAALYVG
FT                   RGGQVGVRRGTWLVERLSGFWGVSLLALVPLCGLFGRIAVRSIGRERLRRALGWGVPLL
FT                   LTAILPVFGDWLLDTYLSPFALDSTDVKAGLTDSVHRVDTPTAAMRCGTRWPSGRAA"
     MAAVPSVAGR IAGAVAERAE DRLARSLWRS HLVLEGAGFA ALYVGRGGQV GVRRGTWLVE        60
     RLSGFWGVSL LALVPLCGLF GRIAVRSIGR ERLRRALGWG VPLLLTAILP VFGDWLLDTY       120
     LSPFALDSTD VKAGLTDSVH RVDTPTAAMR CGTRWPSGRA A                           161
//

If you have problems or comments...

PBIL Back to PBIL home page