(data stored in ACNUC1104 zone)

EMBL: AM420293.PE513

AM420293.PE513       Location/Qualifiers
FT   CDS             complement(576336..578306)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99868"
FT                   /db_xref="GOA:A4F744"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A4F744"
FT                   /protein_id="CAL99868.1"
FT                   /translation="MRGPWRAAFALALHIGFFALPIGLVAGLLAIAVFTFGYDRGSGLR
FT                   VALVALVVGAVLGVGMRAVLRSRNRPRGVALSRSEHPQLWKAVDAICSAAHTAAPDEIR
FT                   VTSEPNAFVREDTALLGLRTRARYLEVGLPLLAGLTASELRAVLAHEIGHLAARGRLTA
FT                   MAYRASTSVERAASDLTGGPTKWLFGGYARLYSAAAGSTSPDLELAADAVAVRVTGKRA
FT                   AVTALRKATAIEFGWREYAESYLSMAVSVERTPDVLLGFRAFMENSVRKPKLAERAKQA
FT                   IAAESAGDSGHPTTRERIAAMKRMSGADKELDDRPAFALLRNPRKSVPVLEDRLLVDGL
FT                   GPRMPWPELARLAGAEHVAHQASLLSSAVAQSGITTDPAIGGVLQAVHRGEGPDLVNPV
FT                   LNPGLAPDRIAEAAVDTLTELLGGAVVDALVSAGRAHHELDWAGPSVVRLTNGRPLDPD
FT                   RLVRPAVADPRLVPGLHRALVDLGVPLNHSRPPAEEPEASVAGLVSPVELAGSRYDMVV
FT                   TDRGLVLLPTTASTAQRLLAGAVARAGRAERKQLAELAATPVAELRERRDAQWVDSRDV
FT                   ASARLLQERRGWTLVLDLYLDEYAVSSLDEGSVAPDADGAASAELRSTPDSMEHGDPYS
FT                   GLGELMGARMDIDDQRDLTEE"
     MRGPWRAAFA LALHIGFFAL PIGLVAGLLA IAVFTFGYDR GSGLRVALVA LVVGAVLGVG        60
     MRAVLRSRNR PRGVALSRSE HPQLWKAVDA ICSAAHTAAP DEIRVTSEPN AFVREDTALL       120
     GLRTRARYLE VGLPLLAGLT ASELRAVLAH EIGHLAARGR LTAMAYRAST SVERAASDLT       180
     GGPTKWLFGG YARLYSAAAG STSPDLELAA DAVAVRVTGK RAAVTALRKA TAIEFGWREY       240
     AESYLSMAVS VERTPDVLLG FRAFMENSVR KPKLAERAKQ AIAAESAGDS GHPTTRERIA       300
     AMKRMSGADK ELDDRPAFAL LRNPRKSVPV LEDRLLVDGL GPRMPWPELA RLAGAEHVAH       360
     QASLLSSAVA QSGITTDPAI GGVLQAVHRG EGPDLVNPVL NPGLAPDRIA EAAVDTLTEL       420
     LGGAVVDALV SAGRAHHELD WAGPSVVRLT NGRPLDPDRL VRPAVADPRL VPGLHRALVD       480
     LGVPLNHSRP PAEEPEASVA GLVSPVELAG SRYDMVVTDR GLVLLPTTAS TAQRLLAGAV       540
     ARAGRAERKQ LAELAATPVA ELRERRDAQW VDSRDVASAR LLQERRGWTL VLDLYLDEYA       600
     VSSLDEGSVA PDADGAASAE LRSTPDSMEH GDPYSGLGEL MGARMDIDDQ RDLTEE           656
//

If you have problems or comments...

PBIL Back to PBIL home page