(data stored in ACNUC1104 zone)

EMBL: AM420293.PE515

AM420293.PE515       Location/Qualifiers
FT   CDS             579777..580460
FT                   /transl_table=11
FT                   /locus_tag="SACE_0524"
FT                   /product="hypothetical protein"
FT                   /function="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99870"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:A4F746"
FT                   /protein_id="CAL99870.1"
FT                   /translation="MQVRTRHTPSFGVARLLLAPGEPVQVESGAMLATSYGVTVESRAQ
FT                   GGFLKSLARAALGGESLYVSTYTAPQQGGWVDVAPNLPGDLNVIELDGRTGWCVTRGCW
FT                   LASASTAQMETQWGGFQNLFGGEGGFMTHVAGHGPVVVSCYGALDVMTLQPGEFVTVDT
FT                   GHVVAYADAVQTRLRQINQGIAQSLKSGEGLVFDFAGPGQVLTQTRNPRGLVSWLQANG
FT                   LGSRS"
     MQVRTRHTPS FGVARLLLAP GEPVQVESGA MLATSYGVTV ESRAQGGFLK SLARAALGGE        60
     SLYVSTYTAP QQGGWVDVAP NLPGDLNVIE LDGRTGWCVT RGCWLASAST AQMETQWGGF       120
     QNLFGGEGGF MTHVAGHGPV VVSCYGALDV MTLQPGEFVT VDTGHVVAYA DAVQTRLRQI       180
     NQGIAQSLKS GEGLVFDFAG PGQVLTQTRN PRGLVSWLQA NGLGSRS                     227
//

If you have problems or comments...

PBIL Back to PBIL home page