(data stored in ACNUC1104 zone)

EMBL: AM420293.PE516

AM420293.PE516       Location/Qualifiers
FT   CDS             580706..580909
FT                   /transl_table=11
FT                   /locus_tag="SACE_0525"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /function="Cold shock proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99871"
FT                   /db_xref="GOA:A4F747"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A4F747"
FT                   /protein_id="CAL99871.1"
FT                   /translation="MAVGTVKWFNSEKGYGFIATDGGSDVFVHYSAINMSGFRTLAEGD
FT                   RVEFEVKAGRDGRSQADGVRKL"
     MAVGTVKWFN SEKGYGFIAT DGGSDVFVHY SAINMSGFRT LAEGDRVEFE VKAGRDGRSQ        60
     ADGVRKL                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page