(data stored in ACNUC1104 zone)

EMBL: AM420293.PE52

AM420293.PE52        Location/Qualifiers
FT   CDS             complement(73710..75083)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0054"
FT                   /product="pyridoxal-dependent decarboxylase family protein,
FT                   putative"
FT                   /function="Glutamate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99407"
FT                   /db_xref="GOA:A4F5T3"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5T3"
FT                   /protein_id="CAL99407.1"
FT                   /translation="MDLRRWLTTAVAEVERWQEEFGDFTTHPAAEVADQELGPAFAELA
FT                   ERLRDNYPFFHPRYAGQMIKPAHPAAVAGHLAAMLVNPNNHALDGGPATARMEREVVAR
FT                   LAGVFGYGPDHLGHLTTSGTIANLEALYVARETHPGRAVAHSADAHYTHSRMCRLLGVE
FT                   AVPVPTDNAGRMDLDALDSLLRTHDIGTVVLTAGTTGLGAIDPVHEALALRERYGVRLH
FT                   VDAAYGGFFTLIADDSPDGVASAPFQALGACDSLVVDPHKHGLQPYGCGAVLFADPAAE
FT                   RFYRHDSPYTYFTSAERHLGEVSLECSRAGAAAAALWLTFRLLPPTPDGLGRVLRPGRR
FT                   AALRWADLLSESPVLAPYQRPELDIVTYLPRAGRLSDIDALSAAVLEGGMTAPAAESVF
FT                   VATYGVDRPALAARGHEVEADVAVGRILRSVLMKPEHDDWLDYLHTRIEELVRTAAGR"
     MDLRRWLTTA VAEVERWQEE FGDFTTHPAA EVADQELGPA FAELAERLRD NYPFFHPRYA        60
     GQMIKPAHPA AVAGHLAAML VNPNNHALDG GPATARMERE VVARLAGVFG YGPDHLGHLT       120
     TSGTIANLEA LYVARETHPG RAVAHSADAH YTHSRMCRLL GVEAVPVPTD NAGRMDLDAL       180
     DSLLRTHDIG TVVLTAGTTG LGAIDPVHEA LALRERYGVR LHVDAAYGGF FTLIADDSPD       240
     GVASAPFQAL GACDSLVVDP HKHGLQPYGC GAVLFADPAA ERFYRHDSPY TYFTSAERHL       300
     GEVSLECSRA GAAAAALWLT FRLLPPTPDG LGRVLRPGRR AALRWADLLS ESPVLAPYQR       360
     PELDIVTYLP RAGRLSDIDA LSAAVLEGGM TAPAAESVFV ATYGVDRPAL AARGHEVEAD       420
     VAVGRILRSV LMKPEHDDWL DYLHTRIEEL VRTAAGR                                457
//

If you have problems or comments...

PBIL Back to PBIL home page