(data stored in ACNUC1104 zone)

EMBL: AM420293.PE520

AM420293.PE520       Location/Qualifiers
FT   CDS             586356..588335
FT                   /transl_table=11
FT                   /locus_tag="SACE_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99875"
FT                   /db_xref="InterPro:IPR011496"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:A4F751"
FT                   /protein_id="CAL99875.1"
FT                   /translation="MAALLGAVALLAGCTDQPAGRPAEETPGTSGALPATGVPQVTPQP
FT                   KKIERLGDDIAVRGRVQLVVDPMADKPTRDLAVRVLEMAGADEVLVREPGQPEQSAHLT
FT                   VRLGDRGAPGVTKGLQELGFHAPMPTPPEGYVLAGRGGDQPTLVMGASDPSGAYYAVQT
FT                   LRQLVSPGRIAGVGVSDSPRMPIRGSIEGFYGSPWTHAERMDQLAFYGDVKLNTYVYAP
FT                   KDDPYHREQWRDPYPPDKLAEVKELIGQAAAHHVKFTFALSPGNSICYSDPRDVQTLVN
FT                   KLRAVHDAGVRDFSIPLDDISYTRWNCPQDQAHYGAPSQGAAGRAQTDLLNQVQREFIA
FT                   THPDVSPLQMVPTEYSDVEDSPYKTALRTGLDPRVLVMWTGDGVIPRRISVADAKAAEK
FT                   VWGRKVFIWDNYPVNDFDNSVGRLMLGPYAKREPGLSAQVVGDVVNPMNQAAASKVVEI
FT                   GAADFSWNDEDFDAQRAWRAAAEYLAGDRFAGGRPGLSADPATVDSLLVFFDLEHMAPL
FT                   ASGKPWLEPAPELARRIAEFNRAWQAGDRAGAIAGLRGYAQAIKDAPQRIRAGAAPDFV
FT                   SDSGPWLDATVLWGDALLATLDGLEARAGRDEARAGERFAAAGKLADQAGQVHTVPGES
FT                   RPQGPVRVADGVLDVFVEQAPGLR"
     MAALLGAVAL LAGCTDQPAG RPAEETPGTS GALPATGVPQ VTPQPKKIER LGDDIAVRGR        60
     VQLVVDPMAD KPTRDLAVRV LEMAGADEVL VREPGQPEQS AHLTVRLGDR GAPGVTKGLQ       120
     ELGFHAPMPT PPEGYVLAGR GGDQPTLVMG ASDPSGAYYA VQTLRQLVSP GRIAGVGVSD       180
     SPRMPIRGSI EGFYGSPWTH AERMDQLAFY GDVKLNTYVY APKDDPYHRE QWRDPYPPDK       240
     LAEVKELIGQ AAAHHVKFTF ALSPGNSICY SDPRDVQTLV NKLRAVHDAG VRDFSIPLDD       300
     ISYTRWNCPQ DQAHYGAPSQ GAAGRAQTDL LNQVQREFIA THPDVSPLQM VPTEYSDVED       360
     SPYKTALRTG LDPRVLVMWT GDGVIPRRIS VADAKAAEKV WGRKVFIWDN YPVNDFDNSV       420
     GRLMLGPYAK REPGLSAQVV GDVVNPMNQA AASKVVEIGA ADFSWNDEDF DAQRAWRAAA       480
     EYLAGDRFAG GRPGLSADPA TVDSLLVFFD LEHMAPLASG KPWLEPAPEL ARRIAEFNRA       540
     WQAGDRAGAI AGLRGYAQAI KDAPQRIRAG AAPDFVSDSG PWLDATVLWG DALLATLDGL       600
     EARAGRDEAR AGERFAAAGK LADQAGQVHT VPGESRPQGP VRVADGVLDV FVEQAPGLR        659
//

If you have problems or comments...

PBIL Back to PBIL home page