(data stored in ACNUC1104 zone)

EMBL: AM420293.PE521

AM420293.PE521       Location/Qualifiers
FT   CDS             complement(588340..588573)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0530"
FT                   /product="hypothetical protein"
FT                   /function="putative stress-responsive transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99876"
FT                   /db_xref="GOA:A4F752"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:A4F752"
FT                   /protein_id="CAL99876.1"
FT                   /translation="MTENSNVHHFSTAETTESRRFRRSREDSMIAGVCGGAARALDVDA
FT                   TLIRVVLVAATLLGFGMGILLYLACWLIVPQE"
     MTENSNVHHF STAETTESRR FRRSREDSMI AGVCGGAARA LDVDATLIRV VLVAATLLGF        60
     GMGILLYLAC WLIVPQE                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page