(data stored in ACNUC1104 zone)

EMBL: AM420293.PE523

AM420293.PE523       Location/Qualifiers
FT   CDS             589507..589893
FT                   /transl_table=11
FT                   /locus_tag="SACE_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99878"
FT                   /db_xref="UniProtKB/TrEMBL:A4F754"
FT                   /protein_id="CAL99878.1"
FT                   /translation="MFEVLESGPPREVAVAAARHVVEWSRRNTAQARVLLAGSAAFGES
FT                   EWTPQARDELRRLNEEMFAAMAEVARGTGTCGELGYGRFSLAVVDLPIAVVRRNLTRGD
FT                   EIPEHEVAVVVEAVRDLLADGQGR"
     MFEVLESGPP REVAVAAARH VVEWSRRNTA QARVLLAGSA AFGESEWTPQ ARDELRRLNE        60
     EMFAAMAEVA RGTGTCGELG YGRFSLAVVD LPIAVVRRNL TRGDEIPEHE VAVVVEAVRD       120
     LLADGQGR                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page