(data stored in ACNUC1104 zone)

EMBL: AM420293.PE527

AM420293.PE527       Location/Qualifiers
FT   CDS             593252..593812
FT                   /transl_table=11
FT                   /locus_tag="SACE_0536"
FT                   /product="carbon monoxide dehydrogenase small chain"
FT                   /function="Aerobic-type carbon monoxide dehydrogenase,small
FT                   subunit CoxS/CutS homologs"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99882"
FT                   /db_xref="GOA:A4F758"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A4F758"
FT                   /protein_id="CAL99882.1"
FT                   /translation="MPRITVNVDGTRYTDDVEPRTLLVHHLRERLGKVGTVVGCDTSNC
FT                   GACTVHLDGQSVKSCSVLAVQADGCEVTTIEGLARDGELHPLQQAFHDNHALQCGFCTP
FT                   GMIMQALDLLAENPDPDTDEVREGLEGNLCRCTGYQNIVKAVRDAAQKMRPGAGPPIEH
FT                   TEDTPMQRTGQEQDTKVTGGRQS"
     MPRITVNVDG TRYTDDVEPR TLLVHHLRER LGKVGTVVGC DTSNCGACTV HLDGQSVKSC        60
     SVLAVQADGC EVTTIEGLAR DGELHPLQQA FHDNHALQCG FCTPGMIMQA LDLLAENPDP       120
     DTDEVREGLE GNLCRCTGYQ NIVKAVRDAA QKMRPGAGPP IEHTEDTPMQ RTGQEQDTKV       180
     TGGRQS                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page