(data stored in ACNUC1104 zone)

EMBL: AM420293.PE528

AM420293.PE528       Location/Qualifiers
FT   CDS             593809..596247
FT                   /transl_table=11
FT                   /locus_tag="SACE_0537"
FT                   /product="carbon monoxide dehydrogenase large subunit"
FT                   /function="Aerobic-type carbon monoxide dehydrogenase,large
FT                   subunit CoxL/CutL homologs"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99883"
FT                   /db_xref="GOA:A4F759"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A4F759"
FT                   /protein_id="CAL99883.1"
FT                   /translation="MTSTLEPELGRSRKRKEDARLITGRTRWTDNLTPTGTLHLAILRS
FT                   PVAHARITSIDTAQAREMSGVVAVLTGRDLADEQGSLPCAWPITEDMKAPTAPSLAVDT
FT                   VNFAGEAVAVVAARSAAEARDALDAIDVDYEDLPVVLDMESALRDDSPLVHEDLGTNRN
FT                   ATWTFDSAEAGTGGNVEEALSAAEVRVERTFRQQRLIPAFMEPRSVVVDPTGDQITMWS
FT                   ATQVPHILRLMLAMTLGEPEHRIRVIAPDVGGGFGGKLQVTPEEVITFLLARRLGRPVK
FT                   WTESRSETMVAAHHGRDQVQKLAISARRDGTITGLKVELLADMGAYLRLVTPGVPILGA
FT                   FMFNAIYKIPAYHFSCTNVFTNKTPTDAYRGAGRPEATFAIERIMDELAAELGMDPMEL
FT                   RRKNWIGHDEFPYTTVAGLTYDSGNYEAATDKAMELFGYDRLREEQAERRRRGDAVQLG
FT                   IGISTFTEMCGLAPSRVLGSLSYGAGGWEHASIRVLPTGKVEVVTGTSPHGQGHETAWS
FT                   QIVADRLGVAFDDVTVLHGDTQSSPKGMDTYGSRSLAVGGIAVVHAADKVVEKAKKIAA
FT                   HLLECSEDDVEFSSGRFGVRGTDRGTALGDIALAAFAAHDLPDGVEPSLDADATYDPDN
FT                   FSFPHGTHLCATEVDTETGRVKIRSYVSVDDVGAVVNPLIVEGQVHGGLAQGIAQALFE
FT                   EAVYDEEGTLTTATLADYLVPSAVDLPEFTTDRTETRATSNPLGVKGVGEAGTIASTPA
FT                   VVNAIVDAVRHLGVDDVEMPCSPQRVWRAVTGARPAESTAPEAGGGLGSIDTSEQGGSR
FT                   "
     MTSTLEPELG RSRKRKEDAR LITGRTRWTD NLTPTGTLHL AILRSPVAHA RITSIDTAQA        60
     REMSGVVAVL TGRDLADEQG SLPCAWPITE DMKAPTAPSL AVDTVNFAGE AVAVVAARSA       120
     AEARDALDAI DVDYEDLPVV LDMESALRDD SPLVHEDLGT NRNATWTFDS AEAGTGGNVE       180
     EALSAAEVRV ERTFRQQRLI PAFMEPRSVV VDPTGDQITM WSATQVPHIL RLMLAMTLGE       240
     PEHRIRVIAP DVGGGFGGKL QVTPEEVITF LLARRLGRPV KWTESRSETM VAAHHGRDQV       300
     QKLAISARRD GTITGLKVEL LADMGAYLRL VTPGVPILGA FMFNAIYKIP AYHFSCTNVF       360
     TNKTPTDAYR GAGRPEATFA IERIMDELAA ELGMDPMELR RKNWIGHDEF PYTTVAGLTY       420
     DSGNYEAATD KAMELFGYDR LREEQAERRR RGDAVQLGIG ISTFTEMCGL APSRVLGSLS       480
     YGAGGWEHAS IRVLPTGKVE VVTGTSPHGQ GHETAWSQIV ADRLGVAFDD VTVLHGDTQS       540
     SPKGMDTYGS RSLAVGGIAV VHAADKVVEK AKKIAAHLLE CSEDDVEFSS GRFGVRGTDR       600
     GTALGDIALA AFAAHDLPDG VEPSLDADAT YDPDNFSFPH GTHLCATEVD TETGRVKIRS       660
     YVSVDDVGAV VNPLIVEGQV HGGLAQGIAQ ALFEEAVYDE EGTLTTATLA DYLVPSAVDL       720
     PEFTTDRTET RATSNPLGVK GVGEAGTIAS TPAVVNAIVD AVRHLGVDDV EMPCSPQRVW       780
     RAVTGARPAE STAPEAGGGL GSIDTSEQGG SR                                     812
//

If you have problems or comments...

PBIL Back to PBIL home page