(data stored in SCRATCH zone)

EMBL: AM420293.PE531

AM420293.PE531       Location/Qualifiers
FT   CDS             598451..598711
FT                   /transl_table=11
FT                   /locus_tag="SACE_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99886"
FT                   /db_xref="UniProtKB/TrEMBL:A4F762"
FT                   /protein_id="CAL99886.1"
FT                   /translation="MARMLVPAALLVASAAFVPMTAQAVETPRTNGDCTNYADDQDINE
FT                   NAAEVACNAKTNDECLAAFSQGGVAPESAKAACDIRARATQ"
     MARMLVPAAL LVASAAFVPM TAQAVETPRT NGDCTNYADD QDINENAAEV ACNAKTNDEC        60
     LAAFSQGGVA PESAKAACDI RARATQ                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page