(data stored in ACNUC1104 zone)

EMBL: AM420293.PE535

AM420293.PE535       Location/Qualifiers
FT   CDS             complement(600922..601515)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99890"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="UniProtKB/TrEMBL:A4F766"
FT                   /protein_id="CAL99890.1"
FT                   /translation="MSAEQHGTTVGGAHRFVGLAENLERHAGRPTGAEPPNVRGDNRGF
FT                   ALVFFHLERYHLTTVISSGLRFQPLGAEPAQELACTVYKEQAEAARHLVDMTAELLVNQ
FT                   RTHLVPDQIVPNEQPLLPHTEFHGVLASGHPLFPPEFTRFTDPEGVEQLQVFTLLPVTL
FT                   GELNFILDNGVTALRQQWARFEVDVFDLGRPSVA"
     MSAEQHGTTV GGAHRFVGLA ENLERHAGRP TGAEPPNVRG DNRGFALVFF HLERYHLTTV        60
     ISSGLRFQPL GAEPAQELAC TVYKEQAEAA RHLVDMTAEL LVNQRTHLVP DQIVPNEQPL       120
     LPHTEFHGVL ASGHPLFPPE FTRFTDPEGV EQLQVFTLLP VTLGELNFIL DNGVTALRQQ       180
     WARFEVDVFD LGRPSVA                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page