(data stored in ACNUC1104 zone)

EMBL: AM420293.PE541

AM420293.PE541       Location/Qualifiers
FT   CDS             605676..606476
FT                   /transl_table=11
FT                   /locus_tag="SACE_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99896"
FT                   /db_xref="GOA:A4F772"
FT                   /db_xref="UniProtKB/TrEMBL:A4F772"
FT                   /protein_id="CAL99896.1"
FT                   /translation="MTYPPQQQGPYGQPGRPQGYPQQPGFPQSGPQAVPGQAWGAPQYG
FT                   PVGAGYPTQTGQVPPGQAPHAQMPPGQVPPGQVPPQGQGFGPPPVPPQPSKGGGGALAA
FT                   KIISGVVALAVVGLILLGINMVSGSGAPEAGECLNLTNNSTVNPDWEVAPCGSADSDFV
FT                   IAKQLGGSESCGEDFSEVSKSGRRTSGYTLCLVPDVKAGDCMNIPQYMGLEEKVACGDA
FT                   DANMEILSVENSTAGESACDYDQEFQYIVYNEPAPGRTICMKQV"
     MTYPPQQQGP YGQPGRPQGY PQQPGFPQSG PQAVPGQAWG APQYGPVGAG YPTQTGQVPP        60
     GQAPHAQMPP GQVPPGQVPP QGQGFGPPPV PPQPSKGGGG ALAAKIISGV VALAVVGLIL       120
     LGINMVSGSG APEAGECLNL TNNSTVNPDW EVAPCGSADS DFVIAKQLGG SESCGEDFSE       180
     VSKSGRRTSG YTLCLVPDVK AGDCMNIPQY MGLEEKVACG DADANMEILS VENSTAGESA       240
     CDYDQEFQYI VYNEPAPGRT ICMKQV                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page