(data stored in SCRATCH zone)

EMBL: AM420293.PE547

AM420293.PE547       Location/Qualifiers
FT   CDS             complement(612263..613282)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0556"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems-like protein"
FT                   /function="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99902"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A4F778"
FT                   /protein_id="CAL99902.1"
FT                   /translation="MSPFPGGGIPRRNLLKLAGGVVTAGALMGTSGCGLLGGSENAGQS
FT                   GPGGLEKANLKVGALATSEIAPLHLAVKNGHFQREGLNVEIVTAKDGASALNAAIGGDY
FT                   DITFSSYVPIFAAQASGVAQLKIVADCASATPNTIMIMTAPGSPVRTAADLAGKKIAIS
FT                   GMGTISQLMVQATMRAHGVDFSRVEWAPIGFPNMPEQLRQGHVDAAFLVEPFLTLAARD
FT                   TKAVPVVDAATGPLQDIPLGGYVSTANFADQNPNTVAAFHRAMQAATDEAQDRSKIEPL
FT                   LPTFAKVDAETAAVMGLLNMHTRVDATRLERVPRLMREFGYIQKDVDVKAMIATPPQN"
     MSPFPGGGIP RRNLLKLAGG VVTAGALMGT SGCGLLGGSE NAGQSGPGGL EKANLKVGAL        60
     ATSEIAPLHL AVKNGHFQRE GLNVEIVTAK DGASALNAAI GGDYDITFSS YVPIFAAQAS       120
     GVAQLKIVAD CASATPNTIM IMTAPGSPVR TAADLAGKKI AISGMGTISQ LMVQATMRAH       180
     GVDFSRVEWA PIGFPNMPEQ LRQGHVDAAF LVEPFLTLAA RDTKAVPVVD AATGPLQDIP       240
     LGGYVSTANF ADQNPNTVAA FHRAMQAATD EAQDRSKIEP LLPTFAKVDA ETAAVMGLLN       300
     MHTRVDATRL ERVPRLMREF GYIQKDVDVK AMIATPPQN                              339
//

If you have problems or comments...

PBIL Back to PBIL home page