(data stored in SCRATCH zone)

EMBL: AM420293.PE548

AM420293.PE548       Location/Qualifiers
FT   CDS             613958..617344
FT                   /transl_table=11
FT                   /locus_tag="SACE_0557"
FT                   /product="sensor signal transduction histidine kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99903"
FT                   /db_xref="GOA:A4F779"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4F779"
FT                   /protein_id="CAL99903.1"
FT                   /translation="MLNNDPGTGGRQDRRVEAQDPHSKRWWLRNWRLRTKMAAVLLVPT
FT                   LAALGVGGIRVYDGMSTADRLNTIVEQVELAQRTADITHELQRERDHAVVQTASGGADR
FT                   VPYDDQARRVDDAIARFRLPESELEDFTPKVREAYQSALNRLSSLNSLRAIVNRGFTDS
FT                   QTLVAYNSVVESVLNVPRAVSSGAANTQLTQSAWAAESISRAKEYLAQQRSILLSAGIR
FT                   NEFFTGQVAQMREADARFEAAFTEFENVASPAQRELYAARVAGAAVDDSEQIKQYALIN
FT                   AENDRALNMNPGEWGAASGTRGDLLRGVEEEVLGEFHDTAKQYADAAWWSMLRDGALIV
FT                   LLLLVAFAVASYIARSMLRPLRTLRYGALEIAEQSLPQAIKQVNENPSGASSVTVPPVP
FT                   VHTREEIGQVARSFDAVHQQALRLASEQALLRTNVNDLFVNLARRSQTLVQRQLSLIDR
FT                   LEQDEQDPDQLSSLFELDHLATRMRRNNENLLILGGTDLTRRMMRPVPLSEVVGAAVSE
FT                   VEQYARIAIAESPDLAIQGRVVNDFVHLIAELLENATVFSNPDTEVTVRTAYRRQELVI
FT                   EIRDRGVGIDDEEIDEINDRLTRPPEVDVAVSRRMGLFVVGQLARRHNIGVQLQNNGDL
FT                   EGGVTATVHLSGEYVVQLTADGPRPMPDIGRPVGGDEPKRDPLSETGTHLGLAAAFGSR
FT                   GGAADRGVDAPTERAPLPPLNFDSPGAPAPSAPAPSSNGFDPSGGPLPQRRKESPAAQE
FT                   AEEQEPVEDLPGNYSFQVSSGGSFGATDIPKWEDDAEASTDDDVRAEQWPSAESAAAAE
FT                   DRELPAAFDGQCGVPAQEEEESPSLFHSPFEAEKTATFEAARPDPDSDGADQNGTRPAP
FT                   DAPLAAGATQDAQDAPGELRASTASDYETEGQPPAVDTQPKGASWDMDDAPTQRLPIYE
FT                   AVLSQWFRESDVDEGGSPLGDSLSSGGGQPPRPARQEAPAEPPSVADGEQALQARRAAE
FT                   PESETGELRATGASGPGGETGEFPEELLAPTGPRDPGWGSADVGWQAAEALVQQSQQVQ
FT                   ETTSAGLPKRVPKSNLVPGSAAPRPQSPAPAKPATTRSPDAVRGRMSNFQQGIRRGRHA
FT                   KADPVSTEPPRSIPSRHEEQE"
     MLNNDPGTGG RQDRRVEAQD PHSKRWWLRN WRLRTKMAAV LLVPTLAALG VGGIRVYDGM        60
     STADRLNTIV EQVELAQRTA DITHELQRER DHAVVQTASG GADRVPYDDQ ARRVDDAIAR       120
     FRLPESELED FTPKVREAYQ SALNRLSSLN SLRAIVNRGF TDSQTLVAYN SVVESVLNVP       180
     RAVSSGAANT QLTQSAWAAE SISRAKEYLA QQRSILLSAG IRNEFFTGQV AQMREADARF       240
     EAAFTEFENV ASPAQRELYA ARVAGAAVDD SEQIKQYALI NAENDRALNM NPGEWGAASG       300
     TRGDLLRGVE EEVLGEFHDT AKQYADAAWW SMLRDGALIV LLLLVAFAVA SYIARSMLRP       360
     LRTLRYGALE IAEQSLPQAI KQVNENPSGA SSVTVPPVPV HTREEIGQVA RSFDAVHQQA       420
     LRLASEQALL RTNVNDLFVN LARRSQTLVQ RQLSLIDRLE QDEQDPDQLS SLFELDHLAT       480
     RMRRNNENLL ILGGTDLTRR MMRPVPLSEV VGAAVSEVEQ YARIAIAESP DLAIQGRVVN       540
     DFVHLIAELL ENATVFSNPD TEVTVRTAYR RQELVIEIRD RGVGIDDEEI DEINDRLTRP       600
     PEVDVAVSRR MGLFVVGQLA RRHNIGVQLQ NNGDLEGGVT ATVHLSGEYV VQLTADGPRP       660
     MPDIGRPVGG DEPKRDPLSE TGTHLGLAAA FGSRGGAADR GVDAPTERAP LPPLNFDSPG       720
     APAPSAPAPS SNGFDPSGGP LPQRRKESPA AQEAEEQEPV EDLPGNYSFQ VSSGGSFGAT       780
     DIPKWEDDAE ASTDDDVRAE QWPSAESAAA AEDRELPAAF DGQCGVPAQE EEESPSLFHS       840
     PFEAEKTATF EAARPDPDSD GADQNGTRPA PDAPLAAGAT QDAQDAPGEL RASTASDYET       900
     EGQPPAVDTQ PKGASWDMDD APTQRLPIYE AVLSQWFRES DVDEGGSPLG DSLSSGGGQP       960
     PRPARQEAPA EPPSVADGEQ ALQARRAAEP ESETGELRAT GASGPGGETG EFPEELLAPT      1020
     GPRDPGWGSA DVGWQAAEAL VQQSQQVQET TSAGLPKRVP KSNLVPGSAA PRPQSPAPAK      1080
     PATTRSPDAV RGRMSNFQQG IRRGRHAKAD PVSTEPPRSI PSRHEEQE                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page