(data stored in ACNUC1104 zone)

EMBL: AM420293.PE550

AM420293.PE550       Location/Qualifiers
FT   CDS             617804..618607
FT                   /transl_table=11
FT                   /locus_tag="SACE_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99905"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="UniProtKB/TrEMBL:A4F781"
FT                   /protein_id="CAL99905.1"
FT                   /translation="MNAGSDPSWDGDLFRLYNKRLSADSWQEDFVDDQQESAGDGVSDY
FT                   SRALFGGPGADLFGSGYSGSGYSNSGYPGSGHSGSGYSAASAEGGDDRRYDSGPSSMSM
FT                   PSISSTSMPSVSMPSISQPMSPISQSMPSISGSMPAIRGGDGPASDEGAGETGSLVRPY
FT                   ARTRGRTRTDYDLAIETLVSTSERGRAQPAASSPEHRSISELCMEARSVAEVAAHLRLP
FT                   LGVVRVLIGDMAGLGLVLIHESGMVVGDRPSMEFLERVLSGLRRL"
     MNAGSDPSWD GDLFRLYNKR LSADSWQEDF VDDQQESAGD GVSDYSRALF GGPGADLFGS        60
     GYSGSGYSNS GYPGSGHSGS GYSAASAEGG DDRRYDSGPS SMSMPSISST SMPSVSMPSI       120
     SQPMSPISQS MPSISGSMPA IRGGDGPASD EGAGETGSLV RPYARTRGRT RTDYDLAIET       180
     LVSTSERGRA QPAASSPEHR SISELCMEAR SVAEVAAHLR LPLGVVRVLI GDMAGLGLVL       240
     IHESGMVVGD RPSMEFLERV LSGLRRL                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page