(data stored in ACNUC1104 zone)

EMBL: AM420293.PE552

AM420293.PE552       Location/Qualifiers
FT   CDS             complement(619555..621804)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99907"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:A4F783"
FT                   /protein_id="CAL99907.1"
FT                   /translation="MPALADWLRERSDDDLVALLRMRPDLATPPPADSSVLATRAGVRS
FT                   SVARACEDLDAFALSTLEALVLLDADVEAASLGAAAELLGVDVTPQRTRRTLDDLRSRA
FT                   LVWGDDDALSISPAVREALPTFPAGLGRPAENLTEAQAKAAIAELDEDERRLIGKLADG
FT                   SPIGRTRDAAAQTPLERAVNPVQRLLAKGLLLRRDAETVELPRQLAFAVRGDHPMGRVE
FT                   PEEPLLDLTDAGASAVDSTAAGEVLELLRHVELLLDLWGQDPPDVLKSGGVGVRDLRRA
FT                   GKAMEVDETRLGLIAELVVAAGLVANSEEAEPRWIPTYQSDSWLASMPETRWAALAQSW
FT                   LDLPRLPGLIGARDEKDRLLGPLSEDLRRPLAPKDRRRVLDVLDELPSGHGVRGADDLA
FT                   AVLAWRAPRKGGRLRDDLVRWTLAEAAVLGITAMGALSTAGRVLLTDGGAEAARHVALP
FT                   EALDHVLVQADLTVVAPGRLEPDLAAEMKLVADVESAGSATVYRVGESSVRRALDAGRT
FT                   ADDLHALFRNRSRTPIPQSLTYLIDDVARRHGQLRAGTASAFLRCDDPVLLAEVLANPA
FT                   VHELELRKIAPTVLVSPLPLADVVDGLRGAGFSPAAEGPDGQVLDLRASGERVRGRNRP
FT                   NPPAAMSAPSDAQLVELVGQVRAGDRAGAARRGSAVSPERGRPSAEATLQLLRDAARER
FT                   RSVWLGFVDSHGVATQRIVRPVRVGGGVLQGLDQSGDSTGTFPLHRITSVALVEE"
     MPALADWLRE RSDDDLVALL RMRPDLATPP PADSSVLATR AGVRSSVARA CEDLDAFALS        60
     TLEALVLLDA DVEAASLGAA AELLGVDVTP QRTRRTLDDL RSRALVWGDD DALSISPAVR       120
     EALPTFPAGL GRPAENLTEA QAKAAIAELD EDERRLIGKL ADGSPIGRTR DAAAQTPLER       180
     AVNPVQRLLA KGLLLRRDAE TVELPRQLAF AVRGDHPMGR VEPEEPLLDL TDAGASAVDS       240
     TAAGEVLELL RHVELLLDLW GQDPPDVLKS GGVGVRDLRR AGKAMEVDET RLGLIAELVV       300
     AAGLVANSEE AEPRWIPTYQ SDSWLASMPE TRWAALAQSW LDLPRLPGLI GARDEKDRLL       360
     GPLSEDLRRP LAPKDRRRVL DVLDELPSGH GVRGADDLAA VLAWRAPRKG GRLRDDLVRW       420
     TLAEAAVLGI TAMGALSTAG RVLLTDGGAE AARHVALPEA LDHVLVQADL TVVAPGRLEP       480
     DLAAEMKLVA DVESAGSATV YRVGESSVRR ALDAGRTADD LHALFRNRSR TPIPQSLTYL       540
     IDDVARRHGQ LRAGTASAFL RCDDPVLLAE VLANPAVHEL ELRKIAPTVL VSPLPLADVV       600
     DGLRGAGFSP AAEGPDGQVL DLRASGERVR GRNRPNPPAA MSAPSDAQLV ELVGQVRAGD       660
     RAGAARRGSA VSPERGRPSA EATLQLLRDA ARERRSVWLG FVDSHGVATQ RIVRPVRVGG       720
     GVLQGLDQSG DSTGTFPLHR ITSVALVEE                                         749
//

If you have problems or comments...

PBIL Back to PBIL home page