(data stored in ACNUC1104 zone)

EMBL: AM420293.PE554

AM420293.PE554       Location/Qualifiers
FT   CDS             622482..623936
FT                   /transl_table=11
FT                   /locus_tag="SACE_0563"
FT                   /product="malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /function="Malic enzyme"
FT                   /EC_number="1.1.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99909"
FT                   /db_xref="GOA:A4F785"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A4F785"
FT                   /protein_id="CAL99909.1"
FT                   /translation="MPVPGPGYSITVRVEAPPSASAAGDLTGSVGRAGGVITAFDVVES
FT                   HADRIVVDITCNALSADHANDITDGLRELPGVTVRKVSDRTFLVHLGGKIEVNSRVALT
FT                   NRDDLSRAYTPGVARVCTAIAENPEDARRLTIKRNSVAVVTDGSAVLGLGNIGPEAALP
FT                   VMEGKAALFKKFAGVNAWPVCLDTQDTEEIIRAVELIAPVYGGINLEDIAAPRCFEIER
FT                   RLREKLNIPVFHDDQHGTAVVVLGALRNALRVVGKDLADCRVVVCGVGAAGSAIIRLLQ
FT                   KKGPADVIAVDIDGIVHTGRGDSDPNLQSIAANTNAEGRTGTLSDAVAGADVFIGVSAP
FT                   NLLNAEEVATMNSDAIVFALANPDPEIDPLEAQKHAKVVATGRSDYPNQINNVLAFPGV
FT                   FRGLLDAHAHEITDDMMIAASNAIADVVDGERLNASFIVPSVFDSAVAPAVADAVRKAA
FT                   TAGRTARPAPVGGSSLPWSMAEDLEY"
     MPVPGPGYSI TVRVEAPPSA SAAGDLTGSV GRAGGVITAF DVVESHADRI VVDITCNALS        60
     ADHANDITDG LRELPGVTVR KVSDRTFLVH LGGKIEVNSR VALTNRDDLS RAYTPGVARV       120
     CTAIAENPED ARRLTIKRNS VAVVTDGSAV LGLGNIGPEA ALPVMEGKAA LFKKFAGVNA       180
     WPVCLDTQDT EEIIRAVELI APVYGGINLE DIAAPRCFEI ERRLREKLNI PVFHDDQHGT       240
     AVVVLGALRN ALRVVGKDLA DCRVVVCGVG AAGSAIIRLL QKKGPADVIA VDIDGIVHTG       300
     RGDSDPNLQS IAANTNAEGR TGTLSDAVAG ADVFIGVSAP NLLNAEEVAT MNSDAIVFAL       360
     ANPDPEIDPL EAQKHAKVVA TGRSDYPNQI NNVLAFPGVF RGLLDAHAHE ITDDMMIAAS       420
     NAIADVVDGE RLNASFIVPS VFDSAVAPAV ADAVRKAATA GRTARPAPVG GSSLPWSMAE       480
     DLEY                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page