(data stored in ACNUC1104 zone)

EMBL: AM420293.PE557

AM420293.PE557       Location/Qualifiers
FT   CDS             complement(626428..627033)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0567"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99912"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A4F788"
FT                   /protein_id="CAL99912.1"
FT                   /translation="MARYHGKHRKPSNAARAAARVAVAGAVIATPLAIAAPANAADWDA
FT                   LAQCESSGNWSANTGNGFSGGLQFTPSTWAAYGGTQYASNAKDATREEQIAVAEKVLAS
FT                   QGKNAWPGCSAKLNWSGGSTKTTKKVTKTETKTQTRTQTKTTSPVQTGGGDYTVQLGDT
FT                   LGKIGEKFGVDYKKIAERNSDIIKDPNLIFPGQKLDIK"
     MARYHGKHRK PSNAARAAAR VAVAGAVIAT PLAIAAPANA ADWDALAQCE SSGNWSANTG        60
     NGFSGGLQFT PSTWAAYGGT QYASNAKDAT REEQIAVAEK VLASQGKNAW PGCSAKLNWS       120
     GGSTKTTKKV TKTETKTQTR TQTKTTSPVQ TGGGDYTVQL GDTLGKIGEK FGVDYKKIAE       180
     RNSDIIKDPN LIFPGQKLDI K                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page