(data stored in ACNUC1104 zone)

EMBL: AM420293.PE563

AM420293.PE563       Location/Qualifiers
FT   CDS             632079..633239
FT                   /transl_table=11
FT                   /locus_tag="SACE_0573"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /function="ABC-type sulfate/molybdate transport
FT                   systems,ATPase component"
FT                   /EC_number="3.6.3.29"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99918"
FT                   /db_xref="GOA:A4F794"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F794"
FT                   /protein_id="CAL99918.1"
FT                   /translation="MSLRADIEVRRDEFALGAELTVAPGRVLAVLGPNGAGKSTLLSAL
FT                   SGLLTPDRGRIELGGHVWLDTERRVRVPTHRRGVGLLAQNALLFPYLTALENVAFGPRA
FT                   SGLGKAEARRTAAHWLSEVDAAELADRKPGQLSGGQAQRVALARALAADPKLLLLDEPL
FT                   AALDIDAAPAMRGLLHRVLRRQQRPTVLVTHDVLDAVVLADELVVLLDGRIVEAGPTRQ
FT                   VLSRPREAFTARIAGLNLLPGVAADGGLELVGGTTASVAMEPGSGAAGGAEGQDGAAVA
FT                   LHGRVAEPLEAGEPAAAVFAPSAVAVHRDRPHGSPRNTIPVRLTGLEPRGDVVRVRGAV
FT                   RDCPLAADVTPAAVADLSLVPGDEVWFVVKAAEVAIHPVSGGSSGA"
     MSLRADIEVR RDEFALGAEL TVAPGRVLAV LGPNGAGKST LLSALSGLLT PDRGRIELGG        60
     HVWLDTERRV RVPTHRRGVG LLAQNALLFP YLTALENVAF GPRASGLGKA EARRTAAHWL       120
     SEVDAAELAD RKPGQLSGGQ AQRVALARAL AADPKLLLLD EPLAALDIDA APAMRGLLHR       180
     VLRRQQRPTV LVTHDVLDAV VLADELVVLL DGRIVEAGPT RQVLSRPREA FTARIAGLNL       240
     LPGVAADGGL ELVGGTTASV AMEPGSGAAG GAEGQDGAAV ALHGRVAEPL EAGEPAAAVF       300
     APSAVAVHRD RPHGSPRNTI PVRLTGLEPR GDVVRVRGAV RDCPLAADVT PAAVADLSLV       360
     PGDEVWFVVK AAEVAIHPVS GGSSGA                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page