(data stored in ACNUC1104 zone)

EMBL: AM420293.PE567

AM420293.PE567       Location/Qualifiers
FT   CDS             complement(635051..635836)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0577"
FT                   /product="phenazine biosynthesis PhzC/PhzF protein"
FT                   /function="predicted epimerase, PhzC/PhzF homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99922"
FT                   /db_xref="GOA:A4F798"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:A4F798"
FT                   /protein_id="CAL99922.1"
FT                   /translation="MRAYVVDSFTDRAFSGNPAGVVLLDAPADAAWMQSVAAELKHSET
FT                   AFVVVGGDAPAKPLRWFTPDTEVPLCGHATLATAHVLGGDQLFDTASGELRCTAGEDGW
FT                   IEMDFPVDVPEPVEPPEELTAGLPGITIEQVAEGATKLLVRAASAAEVRALHPDFDALV
FT                   QVPKPGVVVTAPGDHDGVDFVSRVFAPRVGIPEDPVTGSAHCTLAAWWSTRLDRTGHGA
FT                   EFVGEQASARGGTVRMTLRGDRVGLRGRAVTVLEGELLA"
     MRAYVVDSFT DRAFSGNPAG VVLLDAPADA AWMQSVAAEL KHSETAFVVV GGDAPAKPLR        60
     WFTPDTEVPL CGHATLATAH VLGGDQLFDT ASGELRCTAG EDGWIEMDFP VDVPEPVEPP       120
     EELTAGLPGI TIEQVAEGAT KLLVRAASAA EVRALHPDFD ALVQVPKPGV VVTAPGDHDG       180
     VDFVSRVFAP RVGIPEDPVT GSAHCTLAAW WSTRLDRTGH GAEFVGEQAS ARGGTVRMTL       240
     RGDRVGLRGR AVTVLEGELL A                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page