(data stored in ACNUC1104 zone)

EMBL: AM420293.PE570

AM420293.PE570       Location/Qualifiers
FT   CDS             638017..639336
FT                   /transl_table=11
FT                   /locus_tag="SACE_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99925"
FT                   /db_xref="GOA:A4F7A1"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A1"
FT                   /protein_id="CAL99925.1"
FT                   /translation="MTPPQATGTLTRLTLAAPWRRVDLVLPSETPLGELLPEIVRLLGY
FT                   QTAESPEAYRISLFDGRVVELDQSLRSAAVPDGALLRVDRISEAPMPAVVHDVTDEVAD
FT                   DLDRRPGRWGDDARRWLATAVISAAAVWATLLAAPTTPPPVLVAAGLIALVGGTALALP
FT                   GARVIGTAVLLAGAAATATAVPHWLAEWPLRSLAWAVLVGLTVLAAGAANGRLRAGATG
FT                   AGTLLGLLGLWAVPSALHLPIERTATLLAIVSTVVLGLLPRLALVTSGLTRLDDQQLGE
FT                   RPTTRSSVRAAVDSAHRGLALAVVFAAASAALAGWNLAHASNGWAVALACLLGVTTCLR
FT                   ARACPLTAEVVSLTAATLVVVVGLVSNWLFVAPAQWWGGVLVAVAVLSIGFAALAYRPP
FT                   AHVRARARQLADRVEGVAVVAMVPVAVGVFGIYERLLQTF"
     MTPPQATGTL TRLTLAAPWR RVDLVLPSET PLGELLPEIV RLLGYQTAES PEAYRISLFD        60
     GRVVELDQSL RSAAVPDGAL LRVDRISEAP MPAVVHDVTD EVADDLDRRP GRWGDDARRW       120
     LATAVISAAA VWATLLAAPT TPPPVLVAAG LIALVGGTAL ALPGARVIGT AVLLAGAAAT       180
     ATAVPHWLAE WPLRSLAWAV LVGLTVLAAG AANGRLRAGA TGAGTLLGLL GLWAVPSALH       240
     LPIERTATLL AIVSTVVLGL LPRLALVTSG LTRLDDQQLG ERPTTRSSVR AAVDSAHRGL       300
     ALAVVFAAAS AALAGWNLAH ASNGWAVALA CLLGVTTCLR ARACPLTAEV VSLTAATLVV       360
     VVGLVSNWLF VAPAQWWGGV LVAVAVLSIG FAALAYRPPA HVRARARQLA DRVEGVAVVA       420
     MVPVAVGVFG IYERLLQTF                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page