(data stored in ACNUC1104 zone)

EMBL: AM420293.PE572

AM420293.PE572       Location/Qualifiers
FT   CDS             640949..644755
FT                   /transl_table=11
FT                   /locus_tag="SACE_0582"
FT                   /product="FtsK/SpoIIIE family protein"
FT                   /function="DNA segregation ATPase FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99927"
FT                   /db_xref="GOA:A4F7A3"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A3"
FT                   /protein_id="CAL99927.1"
FT                   /translation="MQGLLPMAGAAASMTMMMFFRGSGFAALGAVVMLVSVCAAALFYF
FT                   TQRGQATRKRRQQRERYLDHLEQLRDDLRDWEQDFQRRASVPDPPVGRLLDLVHDPARL
FT                   WERRRGDTDFLLVRVGTGHQPVRELRMRVEGTPVNPPDSFMLAEANALRRRFGTVPHLP
FT                   LRVNLDRAGDVSLIGEGRDAVLGAARTLIAQVAAMHAPDDVMIAVITPPEREADWAWVR
FT                   WLPHALGRAHIGPGGPQPLFAPDAAALAALLADDLTDRATRAAQAFRHGSGAAEAVTRS
FT                   RLLVIDDAFGDVARKLPTPDKGVGLDRLGVTVLHLLSNRLHEPSEISSRVTVGEQVTVE
FT                   QTEPRAMRAGTLEPASHAFAAGLARELAPLRLSADSYDDGSGTPPADFLQLLGMEDPAK
FT                   LDVDRMWAQRGERDFLRVPIGVTALGNATLLDLKESAQLGMGPHGLCVGATGSGKSELL
FT                   RTLVLALVAAHSPRQLSLVLVDYKGGATFAPFEKLPHTAGLITNLESDSSLVERMYASL
FT                   DGEVQRRQQLLADADKSVDITQYAMRRAALGEPEELPPLQHLFVVIDEFGELMTAKPEF
FT                   IELFLRIGRIGRSIGVHLLLSSQRIEGGKLRGLETYLSYRLGLRTLSEMESRTVLDTPD
FT                   AFHLPPLPGAGYLKVDTSVYDQFKSAYVSGPVAEPEEARPVETGAPRVLAMPRYGSPDE
FT                   QEQTDHPKATRRTIGPTLLSTIVEQLEGAAEPVAPVWLEPLPSAVTLDQAAGGFDVTVD
FT                   GLRLRDTGAAGLPVPMGRLDDPARQWQGTWTLDLSSAGGNLLVLGGPGAGKTTALRTLA
FT                   LGLACAHRPTDIGIYGIDLLGSGMRALADLPHVGGVAGRDDRERIRRTVDELHGMLSER
FT                   ERLFQRRQVDDIAQLRGKPAELPCTEVVLLIDGYGQLAGEFEAIESRVHDLLARGGRYG
FT                   IHVVATARRWNEVRGAQQVGFGNRIELRLTDPAESSIDGKLARAVGAKQLGRALTTDKL
FT                   FAQVALPRLDSVPDPAGSGLPEAAALVRSTWTGPVPPPIRVLPAVLDPRELPATDRGTV
FT                   ALGRFENDFGAANLDLFGRDQHLLVLGDTGTGKTNLLKLVTSTLVRQYPAEEIVFAVFD
FT                   PRHGLEGLVPEDHLGGYASNHALANQLAQAVSQELVKRGSPDHPAGPRIVLVIDDYDVL
FT                   AASGSQPLAPFVPFLASGRDLGLHVVMTRRVMGAARGLFEPFTMGVRESGCLSLLMSGD
FT                   RSEGQLFPGVRPTTLPPGRALHVRPGDQTRTVQTAFLDYLEES"
     MQGLLPMAGA AASMTMMMFF RGSGFAALGA VVMLVSVCAA ALFYFTQRGQ ATRKRRQQRE        60
     RYLDHLEQLR DDLRDWEQDF QRRASVPDPP VGRLLDLVHD PARLWERRRG DTDFLLVRVG       120
     TGHQPVRELR MRVEGTPVNP PDSFMLAEAN ALRRRFGTVP HLPLRVNLDR AGDVSLIGEG       180
     RDAVLGAART LIAQVAAMHA PDDVMIAVIT PPEREADWAW VRWLPHALGR AHIGPGGPQP       240
     LFAPDAAALA ALLADDLTDR ATRAAQAFRH GSGAAEAVTR SRLLVIDDAF GDVARKLPTP       300
     DKGVGLDRLG VTVLHLLSNR LHEPSEISSR VTVGEQVTVE QTEPRAMRAG TLEPASHAFA       360
     AGLARELAPL RLSADSYDDG SGTPPADFLQ LLGMEDPAKL DVDRMWAQRG ERDFLRVPIG       420
     VTALGNATLL DLKESAQLGM GPHGLCVGAT GSGKSELLRT LVLALVAAHS PRQLSLVLVD       480
     YKGGATFAPF EKLPHTAGLI TNLESDSSLV ERMYASLDGE VQRRQQLLAD ADKSVDITQY       540
     AMRRAALGEP EELPPLQHLF VVIDEFGELM TAKPEFIELF LRIGRIGRSI GVHLLLSSQR       600
     IEGGKLRGLE TYLSYRLGLR TLSEMESRTV LDTPDAFHLP PLPGAGYLKV DTSVYDQFKS       660
     AYVSGPVAEP EEARPVETGA PRVLAMPRYG SPDEQEQTDH PKATRRTIGP TLLSTIVEQL       720
     EGAAEPVAPV WLEPLPSAVT LDQAAGGFDV TVDGLRLRDT GAAGLPVPMG RLDDPARQWQ       780
     GTWTLDLSSA GGNLLVLGGP GAGKTTALRT LALGLACAHR PTDIGIYGID LLGSGMRALA       840
     DLPHVGGVAG RDDRERIRRT VDELHGMLSE RERLFQRRQV DDIAQLRGKP AELPCTEVVL       900
     LIDGYGQLAG EFEAIESRVH DLLARGGRYG IHVVATARRW NEVRGAQQVG FGNRIELRLT       960
     DPAESSIDGK LARAVGAKQL GRALTTDKLF AQVALPRLDS VPDPAGSGLP EAAALVRSTW      1020
     TGPVPPPIRV LPAVLDPREL PATDRGTVAL GRFENDFGAA NLDLFGRDQH LLVLGDTGTG      1080
     KTNLLKLVTS TLVRQYPAEE IVFAVFDPRH GLEGLVPEDH LGGYASNHAL ANQLAQAVSQ      1140
     ELVKRGSPDH PAGPRIVLVI DDYDVLAASG SQPLAPFVPF LASGRDLGLH VVMTRRVMGA      1200
     ARGLFEPFTM GVRESGCLSL LMSGDRSEGQ LFPGVRPTTL PPGRALHVRP GDQTRTVQTA      1260
     FLDYLEES                                                               1268
//

If you have problems or comments...

PBIL Back to PBIL home page